GAS8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55508

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAS8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GAS8(growth arrest-specific 8) The peptide sequence was selected from the middle region of GAS8. Peptide sequence RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GAS8 Antibody - BSA Free

Western Blot: GAS8 Antibody [NBP1-55508]

Western Blot: GAS8 Antibody [NBP1-55508]

Western Blot: GAS8 Antibody [NBP1-55508] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
GAS8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Rabbit Polyclonal GAS8 Antibody [NBP1-55508] -

Species tissue/cell type: Human nasal epithelial cellsPrimary antibody dilution: 1:1200Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000

Applications for GAS8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1 : 1200

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAS8

This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Alternate Names

GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8

Gene Symbol

GAS8

UniProt

O95995 (Human)

Additional GAS8 Products

Product Documents for GAS8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAS8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAS8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAS8 Antibody - BSA Free and earn rewards!

Have you used GAS8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies