Gastrokine 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14052

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Gastrokine 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gastrokine 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human stomach shows moderate to strong positivity in mucus in glandular cells.
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Analysis in human stomach and testis tissues. Corresponding GKN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052]

Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Applications for Gastrokine 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gastrokine 1

GKN1, also known as Gastrokine-1, is a 199 amino acid that is approx. 22 kDa, found to be expressed in stomach; has been shown to have mitogenic activity and may be influencing gastric mucosal epithelium. Studies on this protein have shown a relationship with the following diseases and disorders: patent ductus arteriosus, congenital diaphragmatic hernia, respiratory failure, pulmonary hypertension, hernia, gastric cancer, hypertension, gastritis colorectal cancer, and adenocarcinoma. This protein has been linked to positive regulation of cell proliferation, positive regulation of cell division, and digestion pathways.

Long Name

Take out Column D name

Alternate Names

AMP18, BRICD1, CA11, FOV, Foveolin, GKN1

Gene Symbol

GKN1

Additional Gastrokine 1 Products

Product Documents for Gastrokine 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Gastrokine 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gastrokine 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gastrokine 1 Antibody - BSA Free and earn rewards!

Have you used Gastrokine 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies