GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

Novus Biologicals | Catalog # H00002660-M07

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Rat

Applications

Validated:

Western Blot, ELISA

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3E7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GDF8 (NP_005250, 241 a.a. ~ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26730720).

Specificity

GDF8 (3E7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07]

Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07]

Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] - Analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody (M07), clone 3E7. Lane 1: GDF8 transfected lysatE (42.8 KDa). Lane 2: Non-transfected lysate.
Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07]

Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07]

Western Blot: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] - Analysis of GDF8 expression in LNCaP (Cat # L004V1).
GDF-8/Myostatin Antibody (3E7)

Immunocytochemistry/ Immunofluorescence: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] -

Immunocytochemistry/ Immunofluorescence: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] - Myostatin expression in human bladder smooth muscle tissue & cells. (A) Immunofluorescence staining image of myostatin protein (red) in pediatric bladder muscle tissue. Cell nuclei stained with DAPI (blue). 10× magnification (B) Immunofluorescence staining image of myostatin protein (red) in pediatric bladder-derived hSMCs. 20× magnification (C) Flow cytometry comparison of myostatin-positive cells in pediatric bladder-derived control & ESLUTD hSMCs. (D) Representative immunoblot by WES of active myostatin (48 kDa) & its propeptides (100, 52 kDa) in bladder-derived smooth muscle tissue & cells. GAPDH (40 kDa) as a housekeeping protein. * p ≤ 0.05. Scale bar, 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/36901894), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GDF-8/Myostatin Antibody (3E7)

Immunocytochemistry/ Immunofluorescence: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] -

Immunocytochemistry/ Immunofluorescence: GDF-8/Myostatin Antibody (3E7) [H00002660-M07] - Myostatin expression in human bladder smooth muscle tissue & cells. (A) Immunofluorescence staining image of myostatin protein (red) in pediatric bladder muscle tissue. Cell nuclei stained with DAPI (blue). 10× magnification (B) Immunofluorescence staining image of myostatin protein (red) in pediatric bladder-derived hSMCs. 20× magnification (C) Flow cytometry comparison of myostatin-positive cells in pediatric bladder-derived control & ESLUTD hSMCs. (D) Representative immunoblot by WES of active myostatin (48 kDa) & its propeptides (100, 52 kDa) in bladder-derived smooth muscle tissue & cells. GAPDH (40 kDa) as a housekeeping protein. * p ≤ 0.05. Scale bar, 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/36901894), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GDF-8/Myostatin

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth.

Long Name

Growth Differentiation Factor 8

Alternate Names

GDF8, MSLHP, MSTN, Myostatin

Entrez Gene IDs

2660 (Human)

Gene Symbol

MSTN

OMIM

601788 (Human)

Additional GDF-8/Myostatin Products

Product Documents for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

Customer Reviews for GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free and earn rewards!

Have you used GDF-8/Myostatin Antibody (3E7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...