Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # GDF9/4261

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383)

Localization

Cytoplasmic (secreted)

Specificity

GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

1.0 mg/ml of antibody purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS WITHOUT BSA & azide. Also available at 200 ug/ml WITH BSA & azide (NBP3-07273).

Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80 C.

Scientific Data Images for GDF-9 Antibody (GDF9/4261) - Azide and BSA Free

Immunohistochemistry-Paraffin: GDF-9 Antibody (GDF9/4261) - Azide and BSA Free [NBP3-08362]

Immunohistochemistry-Paraffin: GDF-9 Antibody (GDF9/4261) - Azide and BSA Free [NBP3-08362]

Immunohistochemistry-Paraffin: GDF-9 Antibody (GDF9/4261) - Azide and BSA Free [NBP3-08362] - Formalin-fixed, paraffin-embedded human ovary stained with GDF-9 Mouse Monoclonal Antibody (GDF-9/4261).

Applications for GDF-9 Antibody (GDF9/4261) - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1-2 ug/ml

Western Blot

1-2 ug/ml
Application Notes
ELISA: For coating, order antibody without BSA

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

10 mM PBS

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20 to -80C. Avoid freeze-thaw cycles.

Background: GDF-9

GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.

Long Name

Growth Differentiation Factor 9

Alternate Names

GDF9

Gene Symbol

GDF9

Additional GDF-9 Products

Product Documents for GDF-9 Antibody (GDF9/4261) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GDF-9 Antibody (GDF9/4261) - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GDF-9 Antibody (GDF9/4261) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GDF-9 Antibody (GDF9/4261) - Azide and BSA Free and earn rewards!

Have you used GDF-9 Antibody (GDF9/4261) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...