Recombinant Human GFAP GST (N-Term) Protein

Novus Biologicals | Catalog # H00002670-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 131-230 of Human GFAP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human GFAP GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00002670-Q01
Preparation Method in vitro wheat germ expression system
Formulation 51 mM Tris-HCl (pH 8), 10 mM reduced Glutathione, in the elution buffer
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GFAP

Glial fibrillary acidic protein (GFAP) is a class III intermediate filament protein that is largely expressed in astrocytes in addition to non-myelinating Schwann cells and glial cells (1,2). Other members of the type III intermediate filament family include desmin, peripherin, and vimentin (2-4). GFAP was first identified in the brains of multiple sclerosis patients (2). Human GFAP protein is 432 amino acids in length with a theoretical molecular weight of ~50 kDa (1,3). GFAP has at least 10 known isoforms, with the most prevalent and common in the brain being GFAP-alpha which is made of a head domain, a rod domain with four coils (1A, 1B, 2A, 2B) joined by linker regions, and a tail domain (1). GFAP is a marker of mature astrocytes, but is also expressed throughout development in both fetal and adult neural stem cells (2). While the exact function of GFAP is still elusive, it has been shown to play a role in cellular processes such as migration, mitosis, structural integrity, and signaling (2).

An increase in GFAP levels is often associated with neuroinflammation which results in the activation and proliferation of astroglia cell population (1,2). GFAP expression is also observed in brains of patients with neurodegenerative diseases including Alzheimer's and Parkinson's, epilepsy disorders, and brain injuries (1-4). Lesion sites associated with neurodegeneration can exhibit an array of gliosis characteristics from glial scarring with reduced astrocyte proliferation to activated, GFAP-positive astrocytes surrounding amyloid plaques (2). Furthermore, the GFAP gene is a target of single nucleotide polymorphisms in the coding region, considered a gain-of-function mutation, characterized by astrocytic inclusions, termed Rosenthal fibers, resulting in Alexander Disease (1-4). GFAP is also a center of many post-translational modifications, such as phosphorylation, which can alter various aspects of filament assembly (1,4).

References

1. Yang, Z., & Wang, K. K. (2015). Glial fibrillary acidic protein: from intermediate filament assembly and gliosis to neurobiomarker. Trends in Neurosciences. https://doi.org/10.1016/j.tins.2015.04.003

2. Hol, E. M., & Capetanaki, Y. (2017). Type III Intermediate Filaments Desmin, Glial Fibrillary Acidic Protein (GFAP), Vimentin, and Peripherin. Cold Spring Harbor Perspectives in Biology. https://doi.org/10.1101/cshperspect.a021642

3. Potokar, M., Morita, M., Wiche, G., & Jorgacevski, J. (2020). The Diversity of Intermediate Filaments in Astrocytes. Cells. https://doi.org/10.3390/cells9071604

4. Viedma-Poyatos, a., Pajares, M. A., & Perez-Sala, D. (2020). Type III intermediate filaments as targets and effectors of electrophiles and oxidants. Redox Biology. https://doi.org/10.1016/j.redox.2020.101582

Long Name

Glial Fibrillary Acidic Protein

Alternate Names

ALXDRD, FLJ45472, GFAP, GFAP astrocytes, glial fibrillary acidic protein

Gene Symbol

GFAP

Additional GFAP Products

Product Documents for Recombinant Human GFAP GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human GFAP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human GFAP GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human GFAP GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human GFAP GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes