GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14045

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunocytochemistry/Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human kidney shows weak granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human smooth muscle shows strong granular cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human prostate shows strong granular cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Applications for GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFR alpha-1/GDNF R alpha-1

Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRalpha, which is a cell surface receptor for GDNF (1,2). The cDNAs encoding GDNFRalpha from human, rat, chicken and mouse have been cloned recently (1-5). GDNFRalpha was also termed Ret ligand 1 (RETL1) or TGF-beta-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRalpha-1 recently (5-7). GFRalpha-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRalpha and the Ret PTK form a complex to transduce GDNF signal and to mediate GDNF function.

Long Name

Glial Cell line-derived Neurotrophic Factor Receptor alpha 1

Alternate Names

GDNF R alpha-1, GFR alpha1, GFRa-1, GFRA1

Gene Symbol

Gfra1

Additional GFR alpha-1/GDNF R alpha-1 Products

Product Documents for GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free and earn rewards!

Have you used GFR alpha-1/GDNF R alpha-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...