GKAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62650

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK

Reactivity Notes

Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GKAP1 Antibody - BSA Free

Western Blot: GKAP1 Antibody [NBP2-62650]

Western Blot: GKAP1 Antibody [NBP2-62650]

Western Blot: GKAP1 Antibody [NBP2-62650] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Staining of human kidney.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Analysis in human testis and pancreas tissues using Anti-GKAP1 antibody. Corresponding GKAP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Staining of human cerebral cortex, kidney, pancreas and testis using Anti-GKAP1 antibody NBP2-62650 (A) shows similar protein distribution across tissues to independent antibody NBP1-84669 (B).
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650]

Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP2-62650] - Staining of human cerebral cortex.

Applications for GKAP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GKAP1

The GKAP1 gene encodes a G kinase-anchoring protein 1 that is thought to be involved in germ cell development as it localizes with the Golgi and recruits cGMP-dependent protein kinase I alpha to the Golgi in the mouse tests. It exists in two isoforms with isoform 1 at a length of 366 amino acids at 42 kDA and isoform 2 is 315 amino acids long at 36 kDa. The GKAP1 gene has been known to interact with other genes FXR2, HBP1, HGS, PRKG1, and UBQLN4. It has been researched regarding its role in different diseases such as leukemia, ataxia, and pancreatitis.

Alternate Names

cGMP-dependent protein kinase-anchoring protein of 42 kDa, FKSG21, FLJ25469, G kinase anchoring protein 1, G kinase-anchoring protein 1, GKAP42cGMP-dependent protein kinase anchoring protein 42kDa, protein kinase anchoring protein GKAP42

Gene Symbol

GKAP1

Additional GKAP1 Products

Product Documents for GKAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GKAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GKAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GKAP1 Antibody - BSA Free and earn rewards!

Have you used GKAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...