Glut2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48586

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glut2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Glut2 Antibody - BSA Free (NBP2-48586) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Glut2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586]

Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-48586] - Staining in human liver and colon tissues using anti-SLC2A2 antibody. Corresponding SLC2A2 RNA-seq data are presented for the same tissues.

Applications for Glut2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glut2

Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.

Long Name

Glucose Transporter Type 2

Alternate Names

SLC2A2

Gene Symbol

SLC2A2

Additional Glut2 Products

Product Documents for Glut2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glut2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Diabetes
Glucose Homeostasis
Metabolism

Customer Reviews for Glut2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glut2 Antibody - BSA Free and earn rewards!

Have you used Glut2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies