Glutamate Dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54962

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1 (NP_005262). Peptide sequence: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER. The peptide sequence for this immunogen was taken from within the described region.

Marker

Mitochondria Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glutamate Dehydrogenase Antibody - BSA Free

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human brain cortex.
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human Fetal Liver Lysate, concentration 1ug/ml.
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes 8: rat brain supernatant.
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962]

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human pancreas tissue.
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human kidney, renal tubular epithelium in cortex.

Applications for Glutamate Dehydrogenase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutamate Dehydrogenase 1/GLUD1

L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

Alternate Names

GDH, GDH1

Entrez Gene IDs

2746 (Human); 14661 (Mouse); 24399 (Rat)

Gene Symbol

GLUD1

UniProt

Additional Glutamate Dehydrogenase 1/GLUD1 Products

Product Documents for Glutamate Dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutamate Dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutamate Dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutamate Dehydrogenase Antibody - BSA Free and earn rewards!

Have you used Glutamate Dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...