Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82233

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3. Peptide sequence: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

Western Blot: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233]

Western Blot: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233]

Western Blot: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233] - WB Suggested Anti-GPX3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysateGPX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Immunohistochemistry-Paraffin: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 3/GPX3 Antibody [NBP2-82233] - Rabbit Anti-GPX3 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue. Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1/600. Secondary Antibod

Applications for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 3/GPX3

Glutathione Peroxidase 3 (GPX3) belongs to the glutathione peroxidase family. It protects cells and enzymes from oxidative damage by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide by glutathione. There is increasing evidence that GPX3 is a novel tumor suppressor and a therapeutic target for insulin resistance and diabetes mellitus.

GPX-3 antibodies are useful tools for research on cellular response to oxidative stress as well as cancer and diabetes studies.

Alternate Names

GPX-P, GPX3

Gene Symbol

GPX3

Additional Glutathione Peroxidase 3/GPX3 Products

Product Documents for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glutathione Peroxidase 3/GPX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione Peroxidase 3/GPX3 Antibody - BSA Free and earn rewards!

Have you used Glutathione Peroxidase 3/GPX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...