Glycine Receptor Alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86988

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glycine Receptor Alpha 1 Antibody - BSA Free

Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of human liver shows strong cytoplasmic positivity in bile duct cells.
Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of mouse spinal cord shows strong cytoplasmic positivity in neuronal cell bodies and processes in the gray matter.
Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.
Glycine Receptor Alpha 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Immunohistochemistry-Paraffin: Glycine Receptor Alpha 1 Antibody - BSA Free [NBP1-86988]

Staining of human eye, retina shows moderate cytoplasmic positivity in outer nuclear layer and inner plexiform layer..

Applications for Glycine Receptor Alpha 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GLRA1

Glycine is an important inhibitory neurotransmitter in the mammalian central nervous system, especially in the brainstem and spinal cord. It acts by binding to anion-conducting glycine receptors that belong to a superfamily of ligand-gated ion channels. Glycine receptors were first purified as strychnine binding sites in membrane fractions of adult spinal cord from rats (1). These strychnine-sensitive binding sites are different from the strychnine-insensitive binding sites found in the N-methyl-D-aspartate (NMDA) subtype of glutamate receptors. Adult glycine receptors are heterodimers composed of two subunits of 48 kDa and 58 kDa, denoted as a1 and b subunits. Fetal glycine receptors are homomers composed of a2 subunits.

Long Name

Glycine Receptor alpha 1

Alternate Names

HKPX1

Gene Symbol

GLRA1

Additional GLRA1 Products

Product Documents for Glycine Receptor Alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glycine Receptor Alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glycine Receptor Alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycine Receptor Alpha 1 Antibody - BSA Free and earn rewards!

Have you used Glycine Receptor Alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...