Glycoprotein V/CD42d Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17857

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glycoprotein V/CD42d Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Glycoprotein V/CD42d Antibody [NBP3-17857]

Immunocytochemistry/ Immunofluorescence: Glycoprotein V/CD42d Antibody [NBP3-17857]

Immunocytochemistry/Immunofluorescence: Glycoprotein V/CD42d Antibody [NBP3-17857] - Staining of human cell line HEL shows localization to cytosol.

Applications for Glycoprotein V/CD42d Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glycoprotein V/CD42d

GPV (platelet glycoprotein V; designated CD42d) is an 83 kDa type I transmembrane (TM) glycoprotein of the leucine-rich repeat (LRR) family. It is expressed exclusively within the platelet / megakaryocyte lineage, where it noncovalently interacts with other platelet TM LRR proteins, GPIb alpha/beta and GPIX, at a ratio of one GPV to two of each other subunit. The GPI-V-IX complex tethers platelets to von Willebrand factor on the surface of injured endothelial cells. Absence of the complex results in Bernard-Soulier syndrome, a rare bleeding disorder. The human GPV cDNA encodes a 560 amino acid (aa) protein with a 16 aa signal sequence, a 507 aa extracellular domain (ECD) containing 15 LRR, a 21 aa TM sequence, and a short (16 aa) cytoplasmic tail that binds calmodulin in resting, but not activated platelets. The human GPV ECD shares 70%, 71% and 81% aa identity with mouse, rat and equine GPV, respectively. GPV can form soluble fragments of 80 kDa by ADAM10 or ADAM17 cleavage after P507, or 69 kDa by thrombin cleavage after R476. High circulating soluble GPV may be an indicator of platelet activation, but may also be caused by high doses of aspirin. The function of GPV is not entirely clear. Deletion of GPV in mice does not produce any obvious change to surface expression or function of GPIb and GPIX, but surface expression of GPV requires GPIb. Deletion studies also indicate that GPV may play a minor role in collagen adhesion, and may modify platelet aggregation in response to thrombin.

Alternate Names

CD42d, GP5, GPV

Gene Symbol

GP5

Additional Glycoprotein V/CD42d Products

Product Documents for Glycoprotein V/CD42d Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glycoprotein V/CD42d Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glycoprotein V/CD42d Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycoprotein V/CD42d Antibody - BSA Free and earn rewards!

Have you used Glycoprotein V/CD42d Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies