GNG5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14061

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GNG5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GNG5 Antibody - BSA Free

Western Blot: GNG5 Antibody [NBP2-14061]

Western Blot: GNG5 Antibody [NBP2-14061]

Western Blot: GNG5 Antibody [NBP2-14061] - Lane 1: Marker [kDa] 250, 150, 100, 75, 50, 37, 25, 20, 15, 10, 5, 2
Lane 2: Human cell line SK-MEL-30

Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.

Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.

Staining of human testis shows weak cytoplasmic and membranous positivity in cells in seminiferous ducts.

Staining of human testis shows weak cytoplasmic and membranous positivity in cells in seminiferous ducts.

Staining of human pancreas shows weak membranous positivity in exocrine glandular cells.

Staining of human pancreas shows weak membranous positivity in exocrine glandular cells.

Applications for GNG5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNG5

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in varioustransmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement ofGDP by GTP, and for G protein-effector interaction

Alternate Names

FLJ92393, GNGT5, guanine nucleotide binding protein (G protein), gamma 5, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

Gene Symbol

GNG5

Additional GNG5 Products

Product Documents for GNG5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNG5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNG5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNG5 Antibody - BSA Free and earn rewards!

Have you used GNG5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies