GOLGA3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91953
Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for GOLGA3 Antibody - BSA Free
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953]
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human colon, prostate, testis and tonsil using Anti-GOLGA3 antibody NBP1-91953 (A) shows similar protein distribution across tissues to independent antibody NBP1-91952 (B).Western Blot: GOLGA3 Antibody [NBP1-91953]
Western Blot: GOLGA3 Antibody [NBP1-91953] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: GOLGA3 Antibody [NBP1-91953]
Immunocytochemistry/Immunofluorescence: GOLGA3 Antibody [NBP1-91953] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus.Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953]
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.Western Blot: GOLGA3 Antibody [NBP1-91953]
Western Blot: GOLGA3 Antibody [NBP1-91953] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG spImmunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953]
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953]
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953]
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.Western Blot: GOLGA3 Antibody - BSA Free [NBP1-91953]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: GOLGA3 Antibody - BSA Free [NBP1-91953]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Applications for GOLGA3 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GOLGA3
Alternate Names
GCP170Golgi peripheral membrane protein, golgi autoantigen, golgin subfamily a, 3, Golgi complex-associated protein of 170 kD, Golgi complex-associated protein of 170 kDa, Golgi membrane associated protein, golgin A3, Golgin subfamily A member 3, golgin-160, golgin-165, male enhanced antigen-2, MEA-2, SY2/SY10 protein
Gene Symbol
GOLGA3
Additional GOLGA3 Products
Product Documents for GOLGA3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GOLGA3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for GOLGA3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GOLGA3 Antibody - BSA Free and earn rewards!
Have you used GOLGA3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...