GPR64 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84906
![Western Blot: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Western-Blot-NBP1-84906-img0020.jpg "Western Blot: GPR64 Antibody [NBP1-84906]")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0019.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPTVSAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLAQRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for GPR64 Antibody - BSA Free
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0015.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human endometrium, epididymis, liver and skeletal muscle using Anti-ADGRG2 antibody NBP1-84906 (A) shows similar protein distribution across tissues to independent antibody NBP2-55504 (B).![Flow Cytometry: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Flow-Cytometry-NBP1-84906-img0021.jpg "Flow Cytometry: GPR64 Antibody [NBP1-84906]")
Flow Cytometry: GPR64 Antibody [NBP1-84906]
GPR64-Antibody-Flow-Cytometry-NBP1-84906-img0021.jpg![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0014.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human endometrium shows no positivity in glandular cells as expected.![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0016.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human epididymis shows strong positivity in microvilli in glandular cells.![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0017.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human liver shows no positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]](https://resources.rndsystems.com/images/products/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP1-84906-img0018.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]")
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906]
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: GPR64 Antibody [NBP1-84906] -
Expression of selected genes in BCC subsets. (A) Real time PCR for GPR64, FAT4, TMEM98, ALOX5 AP, DUSP4, RAP1A & FN1. The RNA was isolated from Oct4hi, Octmed & Oct4low subsets from MDA-MB-231 stably transfected with pEGFP1-Oct3/4. The results are shown as relative to beta -actin expression with mean ± SD for four independent experiments. (B) Western blots for GPR64, TMEM98, FAT4, RAP1A & FN1 using whole cell extracts expression from Oct4hi, Octmed & Oct4low, isolated as for ‘A’. The results represent four different independent experiments. Image collected & cropped by CiteAb from the following publication (https://www.nature.com/articles/s41598-017-18834-5), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GPR64 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID: 29321622).
Flow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GPR64
Long Name
G Protein-coupled Receptor 64
Alternate Names
EDDM6, HE6, TM7LN2
Gene Symbol
ADGRG2
Additional GPR64 Products
Product Documents for GPR64 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GPR64 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for GPR64 Antibody - BSA Free
Powered by Bioz
Customer Reviews for GPR64 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GPR64 Antibody - BSA Free and earn rewards!
Have you used GPR64 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Liperfluo
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...