GPT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14072

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPT2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPT2 Antibody - BSA Free

Western Blot: GPT2 Antibody [NBP2-14072]

Western Blot: GPT2 Antibody [NBP2-14072]

Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell lines Caco-2 and HeLa using anti-GPT2 antibody. Corresponding GPT2 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072]

Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human lymph node shows very weak positivity in lymphoid cells.
Simple Western: GPT2 Antibody [NBP2-14072]

Simple Western: GPT2 Antibody [NBP2-14072]

Simple Western: GPT2 Antibody [NBP2-14072] - Simple Western lane view shows a specific band for GPT2 in 0.2 mg/ml of HepG2 (left) and h. Kidney (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: GPT2 Antibody [NBP2-14072]

Simple Western: GPT2 Antibody [NBP2-14072]

Simple Western: GPT2 Antibody [NBP2-14072] - Electropherogram image of the corresponding Simple Western lane view. GPT2 antibody was used at 1:25 dilution on HepG2 and h. Kidney lysate(s) respectively.

Applications for GPT2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 and h. Kidney lysates, separated by Size, antibody dilution of 1:25, apparent MW was 59 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPT2

GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.[supplied by OMIM]

Alternate Names

AAT2, alanine aminotransferase 2, ALT2EC 2.6.1.2, Glutamate pyruvate transaminase 2, glutamic pyruvate transaminase (alanine aminotransferase) 2, Glutamic--alanine transaminase 2, glutamic-pyruvate transaminase 2, Glutamic--pyruvic transaminase 2, GPT 2

Gene Symbol

GPT2

Additional GPT2 Products

Product Documents for GPT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GPT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPT2 Antibody - BSA Free and earn rewards!

Have you used GPT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies