GRAMD1A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93730
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQRRVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAHRY
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for GRAMD1A Antibody - BSA Free
Immunohistochemistry-Paraffin: GRAMD1A Antibody [NBP1-93730]
Immunohistochemistry-Paraffin: GRAMD1A Antibody [NBP1-93730] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Western Blot: GRAMD1A Antibody - BSA Free [NBP1-93730] -
Functional Characterization of GRAMD1A in WiT-49 Wilms Tumor Cells. (A) GRAMD1A expression levels in WiT-49 cells, demonstrating baseline expression prior to gene silencing. (B) Verification of GRAMD1A knockdown efficiency in WiT-49 cells transfected with GRAMD1A-specific siRNA (siGRAMD1A) or negative control siRNA (siNC). GRAMD1A mRNA levels were measured using RT-qPCR, while protein levels were assessed via Western blot analysis. (C) Colony formation assay showing the effects of GRAMD1A silencing on the proliferation capability of WiT-49 cells, highlighting reduced colony formation in GRAMD1A knockdown cells compared to siNC. (D) CCK-8 assay results depicting the effect of GRAMD1A knockdown on cell viability over time in WiT-49 cells. Cells transfected with siGRAMD1A exhibited significantly reduced viability compared to control cells, indicating GRAMD1A’s role in promoting cell proliferation. (E) Transwell migration and invasion assays used to assess the impact of GRAMD1A silencing on the migratory and invasive behavior of WiT-49 cells. GRAMD1A knockdown led to a marked reduction in both migration and invasion compared to the negative control group. These results collectively demonstrate the role of GRAMD1A in regulating the proliferation, migration, and invasion of WiT-49 cells, further supporting its potential as a therapeutic target in Wilms Tumor. (*p < 0.05, **p < 0.01, ***p < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39659787), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: GRAMD1A Antibody - BSA Free [NBP1-93730] -
Functional Characterization of GRAMD1A in WiT-49 Wilms Tumor Cells. (A) GRAMD1A expression levels in WiT-49 cells, demonstrating baseline expression prior to gene silencing. (B) Verification of GRAMD1A knockdown efficiency in WiT-49 cells transfected with GRAMD1A-specific siRNA (siGRAMD1A) or negative control siRNA (siNC). GRAMD1A mRNA levels were measured using RT-qPCR, while protein levels were assessed via Western blot analysis. (C) Colony formation assay showing the effects of GRAMD1A silencing on the proliferation capability of WiT-49 cells, highlighting reduced colony formation in GRAMD1A knockdown cells compared to siNC. (D) CCK-8 assay results depicting the effect of GRAMD1A knockdown on cell viability over time in WiT-49 cells. Cells transfected with siGRAMD1A exhibited significantly reduced viability compared to control cells, indicating GRAMD1A’s role in promoting cell proliferation. (E) Transwell migration and invasion assays used to assess the impact of GRAMD1A silencing on the migratory and invasive behavior of WiT-49 cells. GRAMD1A knockdown led to a marked reduction in both migration and invasion compared to the negative control group. These results collectively demonstrate the role of GRAMD1A in regulating the proliferation, migration, and invasion of WiT-49 cells, further supporting its potential as a therapeutic target in Wilms Tumor. (*p < 0.05, **p < 0.01, ***p < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39659787), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GRAMD1A Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GRAMD1A
Alternate Names
FLJ22411, FLJ90346, GRAM domain containing 1A, GRAM domain-containing protein 1A, KIAA1533
Gene Symbol
GRAMD1A
Additional GRAMD1A Products
Product Documents for GRAMD1A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GRAMD1A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for GRAMD1A Antibody - BSA Free
Customer Reviews for GRAMD1A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GRAMD1A Antibody - BSA Free and earn rewards!
Have you used GRAMD1A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...