Granzyme M Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14079

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Granzyme M Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Granzyme M Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining in human lymph node and cerebral cortex tissues using anti-GZMM antibody. Corresponding GZMM RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079]

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining of human cerebral cortex shows low expression as expected.

Applications for Granzyme M Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Granzyme M

The GZMM gene encodes a 257 amino acid long, 27 kDA granzyme M protein that cleaves peptide substrates after methionine, leucine, and norleucine. In doing so, it encourages caspase activation and apoptosis of target cells. GZMM has been investigated for its role in arrhythmogenic right ventricular dysplasia as it participates in the immune system, alternative complement activation, and granzyme pathways. It is known to interact with genes CASP3, DFFA, EZR, NPM1, and PAK2.

Alternate Names

EC 3.4.21, EC 3.4.21.-, granzyme M, granzyme M (lymphocyte met-ase 1), HU-Met-1, LMET1, lymphocyte met-ase 1, Met-1 serine protease, MET1met-ase, Met-ase, Natural killer cell granular protease

Gene Symbol

GZMM

Additional Granzyme M Products

Product Documents for Granzyme M Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Granzyme M Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Granzyme M Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Granzyme M Antibody - BSA Free and earn rewards!

Have you used Granzyme M Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies