GRASP65 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47443

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRASP65 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GRASP65 Antibody - BSA Free

Western Blot: GRASP65 Antibody [NBP2-47443]

Western Blot: GRASP65 Antibody [NBP2-47443]

Western Blot: GRASP65 Antibody [NBP2-47443] - Analysis in control (vector only transfected HEK293T lysate) and GORASP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: GRASP65 Antibody [NBP2-47443]

Immunocytochemistry/ Immunofluorescence: GRASP65 Antibody [NBP2-47443]

Immunocytochemistry/Immunofluorescence: GRASP65 Antibody [NBP2-47443] - Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443] - Staining in human cervix, uterine and skeletal muscle tissues using anti-GORASP1 antibody. Corresponding GORASP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry: GRASP65 Antibody [NBP2-47443] - Staining of human salivary gland shows strong cytoplasmic positivity(dot-like pattern) in glandular cells.
Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443]

Immunohistochemistry-Paraffin: GRASP65 Antibody [NBP2-47443] - Staining of human skeletal muscle shows low expression as expected.

Applications for GRASP65 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRASP65

GRASP65 (Golgi ReAssembly Stacking Protein) is a conserved protein that participates in the stacking of cisternae. This protein associates with GM130 and is phosphorylated by the MEK1 substrate ERK2, Polo-like kinase (Plk) and cdc2-cyclin B. GRASP65 thus plays a role in a cell cycle-dependent reorganization of the Golgi apparatus and may control mammalian cell entry into mitosis.

Alternate Names

Golgi peripheral membrane protein p65, Golgi phosphoprotein 5MGC118897, golgi reassembly stacking protein 1, 65kDa, Golgi reassembly-stacking protein 1, Golgi reassembly-stacking protein of 65 kDa, GRASP65MGC118894, P6565 kDa

Gene Symbol

GORASP1

Additional GRASP65 Products

Product Documents for GRASP65 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRASP65 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRASP65 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRASP65 Antibody - BSA Free and earn rewards!

Have you used GRASP65 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies