GRID1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38495

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRID1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1).

Sequence:
MNSLMDEDIAHKQISPASIELSALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

112 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GRID1 Antibody - BSA Free

GRID1 Antibody

Western Blot: GRID1 Antibody [NBP3-38495] -

Western Blot: GRID1 Antibody [NBP3-38495] - Western blot analysis of various lysates using GRID1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
GRID1 Antibody

Immunocytochemistry/ Immunofluorescence: GRID1 Antibody [NBP3-38495] -

Immunocytochemistry/ Immunofluorescence: GRID1 Antibody [NBP3-38495] - Immunofluorescence analysis of L929 cells using GRID1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GRID1 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting is concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GRID1

GRID1 is subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity (Yamazaki et al., 1992 [PubMed 1372507]).[supplied by OMIM]

Long Name

Glutamate Receptor, Ionotropic, Delta 1

Alternate Names

GluD1, GluR Delta-1 Subunit

Gene Symbol

GRID1

Additional GRID1 Products

Product Documents for GRID1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRID1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRID1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRID1 Antibody - BSA Free and earn rewards!

Have you used GRID1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies