GTF2H3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87539

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GTF2H3. Peptide sequence: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GTF2H3 Antibody - BSA Free

Western Blot: GTF2H3 Antibody [NBP2-87539]

Western Blot: GTF2H3 Antibody [NBP2-87539]

Western Blot: GTF2H3 Antibody [NBP2-87539] - WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:2500. Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry: GTF2H3 Antibody [NBP2-87539]

Immunohistochemistry: GTF2H3 Antibody [NBP2-87539]

Immunohistochemistry: GTF2H3 Antibody [NBP2-87539] - HumanMuscle
Immunohistochemistry-Paraffin: GTF2H3 Antibody [NBP2-87539]

Immunohistochemistry-Paraffin: GTF2H3 Antibody [NBP2-87539]

Immunohistochemistry-Paraffin: GTF2H3 Antibody [NBP2-87539] - Rabbit Anti-GTF2H3 antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: cardiac cell. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for GTF2H3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF2H3

GTF2H3 is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNAand, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB

Alternate Names

Basic transcription factor 2 34 kDa subunit, BTF2, BTF2 p34, General transcription factor IIH polypeptide 3, general transcription factor IIH subunit 3, general transcription factor IIH, polypeptide 3 (34kD subunit), general transcription factor IIH, polypeptide 3, 34kDa, TFB4, TFIIH, TFIIH basal transcription factor complex p34 subunit

Gene Symbol

GTF2H3

Additional GTF2H3 Products

Product Documents for GTF2H3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTF2H3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF2H3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF2H3 Antibody - BSA Free and earn rewards!

Have you used GTF2H3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...