GTF3C5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10489

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GTF3C5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF3C5 (NP_036219). Peptide sequence SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GTF3C5 Antibody - BSA Free

Immunohistochemistry: GTF3C5 Antibody [NBP3-10489]

Immunohistochemistry: GTF3C5 Antibody [NBP3-10489]

Immunohistochemistry: GTF3C5 Antibody [NBP3-10489] - Immunohistochemical analysis of human intestine.

Applications for GTF3C5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF3C5

General transcription factor 3C polypeptide 5 (GTF3C5/TFIIIC63) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. GTF3C5/TFIIIC63 interacts with TFIIIB and may facilitate TFIIIB and RNA polymerase III recruitment in association with TFIIIC102, TFIIIB90, and RPC62.

Alternate Names

FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD

Gene Symbol

GTF3C5

Additional GTF3C5 Products

Product Documents for GTF3C5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTF3C5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF3C5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF3C5 Antibody - BSA Free and earn rewards!

Have you used GTF3C5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies