GTF3C6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31851

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

SDS-Page

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GTF3C6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GTF3C6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GTF3C6 Antibody [NBP2-31851]

Immunocytochemistry/ Immunofluorescence: GTF3C6 Antibody [NBP2-31851]

Immunocytochemistry/Immunofluorescence: GTF3C6 Antibody [NBP2-31851] - Staining of human cell line HEK 293 shows localization to nuclear bodies. Antibody staining is shown in green.
GTF3C6 Antibody

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human cerebral cortex shows strong nuclear positivity in neurons.
GTF3C6 Antibody

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human colon shows strong nuclear positivity in glandular cells.
GTF3C6 Antibody

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
GTF3C6 Antibody

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -

Immunohistochemistry-Paraffin: GTF3C6 Antibody [NBP2-31851] -Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
GTF3C6 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: GTF3C6 Antibody - BSA Free [NBP2-31851]

Chromatin Immunoprecipitation-exo-Seq: GTF3C6 Antibody - BSA Free [NBP2-31851]

ChIP-Exo-Seq composite graph for Anti-GTF3C6 (NBP2-31851) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for GTF3C6 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF3C6

RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcriptionfactors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins(e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmicRNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viralorigin.(supplied by OMIM)

Alternate Names

bA397G5.3, C6orf51chromosome 6 open reading frame 51, general transcription factor 3C polypeptide 6, general transcription factor IIIC, polypeptide 6, alpha 35kDa, TFIIIC35TFIIIC 35 kDa subunit, Transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, Transcription factor IIIC subunit 6

Gene Symbol

GTF3C6

UniProt

Q969F1 (Human)

Additional GTF3C6 Products

Product Documents for GTF3C6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GTF3C6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF3C6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF3C6 Antibody - BSA Free and earn rewards!

Have you used GTF3C6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies