H4/h Antibody (6D4) - Azide and BSA Free

Novus Biologicals | Catalog # H00008365-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 6D4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HIST1H4H (NP_003534, 31 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Specificity

HIST1H4H - histone 1, H4h

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for H4/h Antibody (6D4) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01]

Immunocytochemistry/ Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01]

Immunocytochemistry/Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: H4/h Antibody (6D4) [H00008365-M01] - Detection limit for recombinant GST tagged HIST1H4H is 0.1 ng/ml as a capture antibody.

Applications for H4/h Antibody (6D4) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: H4/h

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Alternate Names

H4 histone family, member H, H4/A, H4/B, H4/C, H4/D, H4/E, H4/h, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FHH4/G, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2H4, HIST2H4A, HIST2H4B, HIST4H4, histone 1, H4h, histone cluster 1, H4h, histone H4

Entrez Gene IDs

8365 (Human)

Gene Symbol

HIST1H4H

OMIM

602828 (Human)

Additional H4/h Products

Product Documents for H4/h Antibody (6D4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H4/h Antibody (6D4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H4/h Antibody (6D4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review H4/h Antibody (6D4) - Azide and BSA Free and earn rewards!

Have you used H4/h Antibody (6D4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...