HA95/AKAP8L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47441

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HA95/AKAP8L Antibody - BSA Free

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human colon.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining in human testis and liver tissues using anti-AKAP8L antibody. Corresponding AKAP8L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human cerebral cortex, colon, kidney and testis using Anti-AKAP8L antibody NBP2-47441 (A) shows similar protein distribution across tissues to independent antibody NBP2-47440 (B).
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human kidney.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human cerebral cortex.

Applications for HA95/AKAP8L Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HA95/AKAP8L

AKAP8L/HA95 is a PKA anchoring protein that is localized to the nuclear envelope and associates with chromatin upon nuclear envelope breakdown during mitosis. AKAP8L/HA95 has been found to play an important role in the initiation of DNA replication and may function as a scaffold for proteins such as MCM2 and LAP2beta. Additionally, AKAP8L/HA95 has been shown to co-locate with the PKA C subunit in splicing factor compartments and is involved in the regulation of pre-mRNA splicing. Further support for a scaffolding and splicing role in the nucleus comes from the observation that AKAP8L/HA95 colocalizes with HypA, a splicing-like factor, and through this association may function as a docking site for the nuclear accumulation of Huntington protein as seen in Huntington's disease.

Alternate Names

A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, HA95, HAP95 DKFZp434L0650, helicase A-binding protein 95 kDa, Homologous to AKAP95 protein, HRIHFB2018, NAKAP, NAKAP95 A-kinase anchor protein 8-like, neighbor of A kinase anchoring protein 95, Neighbor of AKAP95, Neighbor of A-kinase-anchoring protein 95

Gene Symbol

AKAP8L

Additional HA95/AKAP8L Products

Product Documents for HA95/AKAP8L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HA95/AKAP8L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HA95/AKAP8L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HA95/AKAP8L Antibody - BSA Free and earn rewards!

Have you used HA95/AKAP8L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...