HAAO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48755

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDP

Reactivity Notes

Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HAAO Antibody - BSA Free

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human testis.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining in human liver and pancreas tissues using anti-HAAO antibody. Corresponding HAAO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human kidney, liver, small intestine and testis using Anti-HAAO antibody NBP2-48755 (A) shows similar protein distribution across tissues to independent antibody NBP1-85892 (B).
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human small intestine.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755]

Immunohistochemistry-Paraffin: HAAO Antibody [NBP2-48755] - Staining of human kidney.

Applications for HAAO Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAAO

3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. [provided by RefSeq]

Alternate Names

3-HAO, 3-hydroxyanthranilate 3,4-dioxygenase, 3-hydroxyanthranilic acid dioxygenase, EC 1.13.11.6,3-hydroxyanthranilate oxygenase, HAD, HAO

Gene Symbol

HAAO

Additional HAAO Products

Product Documents for HAAO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HAAO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAAO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAAO Antibody - BSA Free and earn rewards!

Have you used HAAO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...