HABP1/C1QBP/GC1q R Antibody (6N7U3)
Novus Biologicals | Catalog # NBP3-15368
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6N7U3 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HABP1/C1QBP/GC1q R (Q07021). KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HABP1/C1QBP/GC1q R Antibody (6N7U3)
Western Blot: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Western Blot: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Western blot analysis of extracts of various cell lines, using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat ovary using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human colon carcinoma using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human esophageal cancer using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse heart using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded rat kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded mouse kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human thyroid cancer tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human liver tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -
Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon carcinoma tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for HABP1/C1QBP/GC1q R Antibody (6N7U3)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: HABP1/C1QBP
Long Name
Hyaluronic Acid-binding Protein
Alternate Names
C1QBP, gC1qBP, gC1qR, SF2p32
Gene Symbol
C1QBP
Additional HABP1/C1QBP Products
Product Documents for HABP1/C1QBP/GC1q R Antibody (6N7U3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HABP1/C1QBP/GC1q R Antibody (6N7U3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for HABP1/C1QBP/GC1q R Antibody (6N7U3)
There are currently no reviews for this product. Be the first to review HABP1/C1QBP/GC1q R Antibody (6N7U3) and earn rewards!
Have you used HABP1/C1QBP/GC1q R Antibody (6N7U3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...