Hairless Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87553

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Hairless Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Hairless. Peptide sequence: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Hairless Antibody - BSA Free

Western Blot: Hairless Antibody [NBP2-87553]

Western Blot: Hairless Antibody [NBP2-87553]

Western Blot: Hairless Antibody [NBP2-87553] - WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: Hairless Antibody [NBP2-87553]

Immunohistochemistry-Paraffin: Hairless Antibody [NBP2-87553]

Immunohistochemistry-Paraffin: Hairless Antibody [NBP2-87553] - Rabbit Anti-HR antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skin. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.

Applications for Hairless Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hairless

HR (hairless) is 1189 amino acids long, weighing approximately 127 kDa, with a short isomer that is 1134 amino acids long, weighing approximately 122 kDa. HR functions as a transcription factor that regulates the phases of hair growth, with strong expressions in the small intestine and the skin (for isoform 2 only), and weak expressions in the brain and colon. Current studies are being done on several diseases and disorders including atrichia with popular lesions, hypotrichosis, thyroiditis, and autosomal recessive diseases. HR has also been shown to have interactions with VDR, ESR2, RARA, TBL1X, and HDAC1.

Alternate Names

ALUNC, AU, HR

Gene Symbol

HR

Additional Hairless Products

Product Documents for Hairless Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hairless Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hairless Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hairless Antibody - BSA Free and earn rewards!

Have you used Hairless Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies