Heparanase/HPSE Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84064

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Heparanase/HPSE. Peptide sequence: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Heparanase/HPSE Antibody - BSA Free

Western Blot: Heparanase/HPSE Antibody [NBP2-84064]

Western Blot: Heparanase/HPSE Antibody [NBP2-84064]

Western Blot: Heparanase/HPSE Antibody [NBP2-84064] - WB Suggested Anti-HPSE Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Immunohistochemistry-Paraffin: Heparanase/HPSE Antibody [NBP2-84064]

Immunohistochemistry-Paraffin: Heparanase/HPSE Antibody [NBP2-84064]

Immunohistochemistry-Paraffin: Heparanase/HPSE Antibody [NBP2-84064] - Rabbit Anti-HPSE antibody. Formalin Fixed Paraffin Embedded Tissue: Human Placenta. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Applications for Heparanase/HPSE Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heparanase/HPSE

Heparanase is an endo-beta-D-glucuronidase, which degrades heparan sulfate side chains of heparan sulfate proteoglycans (HSPGs) in the extracellular matrix. Heparanase plays an important role in ECM degradation, facilitating the migration and extravasations of tumor cells and inflammatory leukocytes. Upon degradation, heparanase releases growth factors and cytokines that stimulate cell proliferation and chemotaxis. Heparanase is a heterodimer comprised of a 50 kDa subunit harboring the active site and an 8 kDa subunit. It is produced as a latent 65 kDa precursor and proteolytically processed to its active form. Heparanase is highly expressed in myeloid leukocytes (i.e. neutrophils) in platelets and in human placenta. Human heparanase was found to be upregulated in various types of primary tumors, correlating in some cases with increased tumor invasiveness and vascularity and with poor prospective survival.

Alternate Names

Endo-glucoronidase, HPA1, HPR1, HPSE, HSE1

Gene Symbol

HPSE

Additional Heparanase/HPSE Products

Product Documents for Heparanase/HPSE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Heparanase/HPSE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Heparanase/HPSE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Heparanase/HPSE Antibody - BSA Free and earn rewards!

Have you used Heparanase/HPSE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail