Hepcidin Antimicrobial Peptide Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59337

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Bovine

Cited:

Human, Mouse, Bovine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hepcidin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Bovine reported in scientific literature (PMID:31811823).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hepcidin Antimicrobial Peptide Antibody - BSA Free

Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337]

Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337]

Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337]

Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337]

Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.
Hepcidin Antimicrobial Peptide Antibody - BSA Free

Western Blot: Hepcidin Antimicrobial Peptide Antibody - BSA Free [NBP1-59337] -

Omniscan-induced cells express iron metabolism proteins.(A) Expression of ferroportin and other iron regulatory protein hepcidin by human PBMC treated with 0.5 mM Omniscan and deferiprone for 8 days, as shown by immunocytochemistry staining. Representative images are shown. Deferiprone treatment significantly decreased Omniscan-induced ferroportin expression as shown by western blot analysis (B) left panel. After Omniscan treatment, hepcidin expression was decreased in comparison to untreated cells (A) lower panels, (B) right panels, western blot. Omniscan treatment with deferiprone increased the expression slightly. Representative blots from 3 separate experiments are shown. Values are means +/-SD, obtained from 3 separate experiments, Significance of the data was determined by ANOVA, followed by paired-group comparisons. **p <0.01, compared with control, *p <0.05 (for hepcidin), **p <0.01 (for ferroportin) deferiprone- and Omniscan-treated compared with Omniscan alone. (Scale bars 100 μm for all). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26305890), licensed under a CC0-1.0 license. Not internally tested by Novus Biologicals.

Applications for Hepcidin Antimicrobial Peptide Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Immunohistochemistry Paraffin (IHC-P) reported in verified customer review.

Reviewed Applications

Read 6 reviews rated 4.5 using NBP1-59337 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hepcidin

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature protein.

Long Name

Hepcidin Antimicrobial Peptide

Alternate Names

HAMP, HEPC, HFE2B, LEAP1, PLTR

Gene Symbol

HAMP

UniProt

P81172

Additional Hepcidin Products

Product Documents for Hepcidin Antimicrobial Peptide Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hepcidin Antimicrobial Peptide Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Red Blood Cells (RBCs)

Citations for Hepcidin Antimicrobial Peptide Antibody - BSA Free

Customer Reviews for Hepcidin Antimicrobial Peptide Antibody - BSA Free (6)

4.5 out of 5
6 Customer Ratings
5 Stars
67%
4 Stars
17%
3 Stars
17%
2 Stars
0%
1 Stars
0%

Have you used Hepcidin Antimicrobial Peptide Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 5 of 6 reviews Showing All
Filter By:
Clear Filters X
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: mouse eye
    Species: Mouse
    Verified Customer | Posted 04/10/2019
    Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Adult pancreas
    Species: Mouse
    Verified Customer | Posted 08/08/2018
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: eye
    Species: Bovine
    Verified Customer | Posted 08/03/2018
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: human eye
    Species: Human
    Verified Customer | Posted 07/13/2018
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Hepcidin peptide
    Species: Human
    Verified Customer | Posted 07/11/2018
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337
  • Hepcidin Antimicrobial Peptide Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Adult eye and muscle tissue (labeled E and M
    Species: Bovine
    Verified Customer | Posted 06/29/2018
    1:500
    Hepcidin Antimicrobial Peptide Antibody - BSA Free NBP1-59337

There are no reviews that match your criteria.

Showing  1 - 5 of 6 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies