HERC5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58102

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HERC5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the middle region of HERC5. Peptide sequence FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HERC5 Antibody - BSA Free

Western Blot: HERC5 Antibody [NBP1-58102]

Western Blot: HERC5 Antibody [NBP1-58102]

Western Blot: HERC5 Antibody [NBP1-58102] - hek293 cell lysate at 1:1000.

Immunohistochemistry-Paraffin: HERC5 Antibody [NBP1-58102] -

Immunohistochemistry-Paraffin: HERC5 Antibody [NBP1-58102] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes; Primary Antibody Concentration: 1:100
Western Blot: HERC5 Antibody [NBP1-58102]

Western Blot: HERC5 Antibody [NBP1-58102]

Western Blot: HERC5 Antibody [NBP1-58102] - Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate

Applications for HERC5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HERC5

HERC5 is a member of the HERC family of ubiquitin ligases.It contains a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulates expression of HERC5 protein in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Alternate Names

CEB1E3 ISG15--protein ligase HERC5, CEBP1, cyclin-E binding protein 1, Cyclin-E-binding protein 1, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 5, hect domain and RLD 5, HECT E3 ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC5

Gene Symbol

HERC5

UniProt

Q69G20 (Human)

Additional HERC5 Products

Product Documents for HERC5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HERC5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HERC5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HERC5 Antibody - BSA Free and earn rewards!

Have you used HERC5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies