Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80446

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Heterogeneous Nuclear Ribonucleoprotein (A1-like) Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

Western Blot: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Western Blot: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Western Blot: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Rabbit Anti-RP11-78J21.1 Antibody. Paraffin Embedded Tissue: Human Skin. Cellular Data: Epidermal cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446]

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Applications for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heterogeneous Nuclear Ribonucleoprotein (A1-like)

The HNRNPA1 gene encodes a heterogeneous nuclear ribonucleoprotein A1-like (part of the hnRNPs) that functions in various processes such as the ordering of pre-mRNA into hnRNP particles, the transport of poly(A) mRNA to the cytoplams from the nucleus, as well as plays a part in the regulation of splice site selection. Additionally, HNRNPA1 also functions in HCV RNA replication. This gene functions in mRNA splicing and processing, coregulation of adrogen receptor activity, and in translational control. it has been known to interact with various genes such as DDV5, ILF3, DDX17, HNRNPC, and ABHD16A. HNRNPA1 has been researched in various diseases including: cystic fibrosis, colorectal cancer, crohn's disease, spinal cord disease, human t-cell leukemia virus type 1 and type 2, muscular atrophy, stomatitis, and metastasis efficiency.

Alternate Names

heterogeneous nuclear ribonucleoprotein A1-like 2, hnRNP A1-like 2, hnRNP core protein A1-like 2, HNRNPA1L, LOC144983, MGC102957

Gene Symbol

HNRNPA1L2

UniProt

NP_001011724 (Human)

Additional Heterogeneous Nuclear Ribonucleoprotein (A1-like) Products

Product Documents for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free and earn rewards!

Have you used Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies