Hexokinase Type III Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38799

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hexokinase Type III Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hexokinase Type III Antibody - BSA Free

Hexokinase Type III Antibody

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Analysis in human bone marrow and kidney tissues using NBP2-38799 antibody. Corresponding HK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799]

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799]

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Staining of human bone marrow shows high expression.
Hexokinase Type III Antibody

Western Blot: Hexokinase Type III Antibody [NBP2-38799] -

Western Blot: Hexokinase Type III Antibody [NBP2-38799] -Analysis in human spleen tissue.
Hexokinase Type III Antibody

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.
Hexokinase Type III Antibody

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.
Hexokinase Type III Antibody

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -

Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human kidney shows negative cytoplasmic positivity in cells in tubules and cells in glomeruli as expected.

Applications for Hexokinase Type III Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hexokinase Type III

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate. [provided by RefSeq]

Long Name

Hexokinase-3

Alternate Names

EC 2.7.1.1, Hexokinase-C, HK III, HK3

Gene Symbol

HK3

UniProt

P52790 (Human)

Additional Hexokinase Type III Products

Product Documents for Hexokinase Type III Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hexokinase Type III Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hexokinase Type III Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hexokinase Type III Antibody - BSA Free and earn rewards!

Have you used Hexokinase Type III Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies