HGK/MAP4K4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58853

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Rabbit

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MAP4K4(mitogen-activated protein kinase kinase kinase kinase 4) The peptide sequence was selected from the N terminal of MAP4K4. Peptide sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HGK/MAP4K4 Antibody - BSA Free

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853]

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853]

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: HGK/MAP4K4 Antibody [NBP1-58853]

Immunohistochemistry: HGK/MAP4K4 Antibody [NBP1-58853]

Immunohistochemistry: HGK/MAP4K4 Antibody [NBP1-58853] - Liver
Western Blot: HGK/MAP4K4 Antibody [NBP1-58853]

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853]

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.
HGK/MAP4K4 Antibody - BSA Free

Western Blot: HGK/MAP4K4 Antibody - BSA Free [NBP1-58853] -

FGF2/FGFR1 mediates MAP4K4 signaling in endothelial cells. (a) Immunofluorescence microscopy analysis of P-MAP4K4 expression following FRS2 siRNA or TGF beta 2 treatment. For each slide, images of six different fields of view at × 400 magnification were evaluated. The scale bar is 60 μm in each panel. (b and c) HMVECs were treated with N-FGFR1 for 48 h or FGF2 for 24 h. The P-MAP4K4 levels were analyzed by western blot Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28771231), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HGK/MAP4K4 Antibody - BSA Free

Western Blot: HGK/MAP4K4 Antibody - BSA Free [NBP1-58853] -

FGF2/FGFR1 mediates MAP4K4 signaling in endothelial cells. (a) Immunofluorescence microscopy analysis of P-MAP4K4 expression following FRS2 siRNA or TGF beta 2 treatment. For each slide, images of six different fields of view at × 400 magnification were evaluated. The scale bar is 60 μm in each panel. (b and c) HMVECs were treated with N-FGFR1 for 48 h or FGF2 for 24 h. The P-MAP4K4 levels were analyzed by western blot Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28771231), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HGK/MAP4K4 Antibody - BSA Free

Western Blot: HGK/MAP4K4 Antibody - BSA Free [NBP1-58853] -

The proximity between FGFR1 and P-MAP4K4 decreases in FGFR1-deficient cells. (a) HMVECs were treated with N-FGFR1 or TGF beta 2 for 48 h. The proximity between FGFR1 and P-MAP4K4 was analyzed using the Duolink In Situ Assay. For each slide, images at × 400 original magnification were obtained from six different areas. (b) immunoprecipitation analysis with either a P-MAP4K4 or a FGFR1 antibody was performed and analyzed by western blot. Then, the FGFR1 and P-MAP4K4 levels with N-FGFR1 or TGF beta 2 treatment were analyzed by western blot in endothelial cells Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28771231), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for HGK/MAP4K4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HGK

MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.

Long Name

Hepatocyte Pogenitor Kinase-like/Germinal Center Knase-like Kinase

Alternate Names

MAP4K4, MEKKK4

Gene Symbol

MAP4K4

Additional HGK Products

Product Documents for HGK/MAP4K4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HGK/MAP4K4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HGK/MAP4K4 Antibody - BSA Free

Customer Reviews for HGK/MAP4K4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HGK/MAP4K4 Antibody - BSA Free and earn rewards!

Have you used HGK/MAP4K4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...