HIF-3 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89977

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HIF-3 alpha/HIF3A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HIF-3 alpha Antibody - BSA Free

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977]

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977]

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human prostate shows moderate to strong cytoplasmic and nuclear positivity in smooth muscle cells.
HIF-3 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
HIF-3 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.
HIF-3 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Immunohistochemistry-Paraffin: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Staining of human Fallopian tube shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.
HIF-3 alpha Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

Chromatin Immunoprecipitation-exo-Seq: HIF-3 alpha Antibody - BSA Free [NBP1-89977]

ChIP-Exo-Seq composite graph for Anti-HIF3A (NBP1-89977) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HIF-3 alpha Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HIF-3 alpha/HIF3A

Hypoxia-inducible factor (HIF) is one of the most important factors in the cellular response to hypoxia, by transcriptionally activating genes encoding proteins that mediate adaptive responses to reduced oxygen availability. HIF is a heterodimer consisting of one of three subunits, HIF1 alpha, HIF2 alpha, or HIF3 alpha. HIF target genes play critical roles in metabolism, angiogenesis, cell proliferation and cell survival. HIF3 alpha protein is one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha 3 subunit lacks the transactivation domain found in factors containing either the alpha 1 or alpha 2 subunits. HIF3 alpha may be a marker for tumor growth and angiogenesis.

Long Name

Hypoxia Inducible Factor 3 Subunit Alpha

Alternate Names

BHLHe17, HIF3A, IPAS, MOP7, PASD7

Entrez Gene IDs

64344 (Human)

Gene Symbol

HIF3A

UniProt

Q9Y2N7 (Human)

Additional HIF-3 alpha/HIF3A Products

Product Documents for HIF-3 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HIF-3 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIF-3 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HIF-3 alpha Antibody - BSA Free and earn rewards!

Have you used HIF-3 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies