HISPPD2A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89693
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Applications
Validated:
Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 29590114).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HISPPD2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693]
Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Validation of anti-PPIP5K2 and anti-PPIP5K1 antibodies specific in vitro. (A) Anti-PPIP5K2 antibody immunofluorescence signal coincides with the signal produced by GFP-tagged WT PPIP5K2, and p.Arg837His variant harboring PPIP5K2 expressed in COS7 cells. (B) The anti-PPIP5K1 antibody immunofluorescence signal coincides with the GFP-tagged PPIP5K1 signal, but not with fluorescently tagged PPIP5K2 expressed in COS7 cells. (C) Western blot tested indicated the specific bands of sizes that correspond to full-length PPIP5K2 around 140 kDa. (D) Western blot on whole protein lysates from mice tissues with specific variants. Citation: Yousaf R, Gu C, Ahmed ZM, Khan SN, Friedman TB, Riazuddin S, et al. (2018) Mutations in Diphosphoinositol-Pentakisphosphate Kinase PPIP5K2 are associated with hearing loss in human and mouse. PLoS Genet 14(3): e1007297Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693]
Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693]
Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - HISPPD2A/PPIP5K1 antibody was used at 1:200 dilution for localizing PPIP5K2 protein in sensory and non-sensory cells of mouse inner ear using confocal microscopy analysis. Figure A shows the real-time PCR expression of Ppip5k2 in adult (P150) mice, normalized against Gapdh (Delta CT) and Ppip5k1 expression (Delta CT). In Figure B, a cross-section through one of the coils of inner ear shows diffuse cytoplasmic immunolabeling of PPIP5K2 throughout the cochlear duct, including spiral ganglion neurons (SG), organ of Corti (OC), and stria vascularis (SV). Figure C shows the expression of PPIP5K2 at the ages tested in WT mice, from early postnatal day P16, up to 9 months of age. Scale bars: 100um (panel A), and 20um (panel C).Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693]
Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.Applications for HISPPD2A Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HISPPD2A
Alternate Names
diphosphoinositol pentakisphosphate kinase 1, histidine acid phosphatase domain-containing protein 2A, inositol pyrophosphate synthase 1, VIP1
Gene Symbol
PPIP5K1
Additional HISPPD2A Products
Product Documents for HISPPD2A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HISPPD2A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for HISPPD2A Antibody - BSA Free
Customer Reviews for HISPPD2A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HISPPD2A Antibody - BSA Free and earn rewards!
Have you used HISPPD2A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...