Histamine H1R Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15963

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human Histamine H1R (NP_000852.1). KPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Histamine H1R Antibody - Azide and BSA Free

Western Blot: Histamine H1R AntibodyAzide and BSA Free [NBP3-15963]

Western Blot: Histamine H1R AntibodyAzide and BSA Free [NBP3-15963]

Western Blot: Histamine H1R Antibody [NBP3-15963] - Western blot analysis of extracts of various cell lines, using Histamine H1R antibody (NBP3-15963) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Western Blot: Histamine H1R AntibodyAzide and BSA Free [NBP3-15963]

Western Blot: Histamine H1R AntibodyAzide and BSA Free [NBP3-15963]

Western Blot: Histamine H1R Antibody [NBP3-15963] - Western blot analysis of extracts of U-251MG cells, using Histamine H1R antibody (NBP3-15963) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Histamine H1R Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Reviewed Applications

Read 1 review rated 3 using NBP3-15963 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histamine H1 R

Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Itsvarious actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless untilrecently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupledreceptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due tocontraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in thecentral nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified.(provided by RefSeq)

Long Name

Histamine H1 Receptor

Alternate Names

H1-R, Histamine H1R, HRH1

Gene Symbol

HRH1

Additional Histamine H1 R Products

Product Documents for Histamine H1R Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histamine H1R Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Histamine H1R Antibody - Azide and BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used Histamine H1R Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Histamine H1R Antibody - Azide and BSA Free
    Name: Pauline Jeannot
    Application: Western Blot
    Sample Tested: IGR-39
    Species: Human
    Verified Customer | Posted 11/16/2023
    Western blot using NBP3-15963 ab at 1:500 dilution. Several non specific band
    Histamine H1R Antibody - Azide and BSA Free NBP3-15963

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...