Histone H1T Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57668

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone H1T Antibody - BSA Free

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Staining of human colon.
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Immunohistochemical staining of human testis shows nuclear positivity in ductus seminiferous.
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Staining of human cerebral cortex, colon, kidney and testis using Anti-HIST1H1T antibody NBP2-57668 (A) shows similar protein distribution across tissues to independent antibody NBP2-56042 (B).
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Staining of human kidney.
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668]

Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Staining of human testis.

Applications for Histone H1T Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Histone H1T

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. Histone H1t is a 207 amino acid long, 22 kDA protein encoded by the gene HIST1H1T that lacks polyA tails and instead obtain palindromic termination elements. H1 histones are critical for the condensation of nucleosome chains into higher order structures. HIST1H1T is found on chromosome 5. HIST1H1T has been investigated in childhood leukemia and hemochromatosis. It is involved in granzyme-A pathway, histone modification, and PKA signaling and is known to interact with various genes such as YWHAQ, YWHAZ, ACTA2, POU5F1, and GSK3B.

Alternate Names

dJ221C16.2, H1 histone family, member T (testis-specific), H1FTMGC163222, H1t, histone 1, H1t, histone cluster 1, H1t, histone H1t, Testicular H1 histone

Gene Symbol

H1-6

Additional Histone H1T Products

Product Documents for Histone H1T Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H1T Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Histone H1T Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Histone H1T Antibody - BSA Free and earn rewards!

Have you used Histone H1T Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...