Histone H2AX is one of a number of core histone proteins. In the cellular response to genotoxic insults, ATM and related protein kinases phosphorylate the carboxyl-terminal tail of the H2AX protein (gamma-H2AX). gamma-H2AX marks the site of damage and provides a nucleation site for the formation of damage response and repair complexes. BRCA1 carboxyl terminal (BRCT) domain-containing proteins are recruited to gamma-H2AX to create a protein scaffold for further assembly of signaling complexes.
Histone H2AX Antibody (4Z3S8)
Novus Biologicals | Catalog # NBP3-15378
Recombinant Monoclonal Antibody
![Western Blot: Histone H2AX Antibody (4Z3S8) [NBP3-15378]](https://resources.rndsystems.com/images/products/Histone-H2AX-Antibody-4Z3S8-Western-Blot-NBP3-15378-img0004.jpg "Western Blot: Histone H2AX Antibody (4Z3S8) [NBP3-15378]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4Z3S8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2AX (P16104). MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Histone H2AX Antibody (4Z3S8)
Western Blot: Histone H2AX Antibody (4Z3S8) [NBP3-15378]
Western Blot: Histone H2AX Antibody (4Z3S8) [NBP3-15378] - Western blot analysis of extracts of various cell lines, using Histone H2AX Rabbit mAb (NBP3-15378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.![Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]](https://resources.rndsystems.com/images/products/Histone-H2AX-Antibody-4Z3S8-Immunohistochemistry-Paraffin-NBP3-15378-img0003.jpg "Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]")
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378] - Immunohistochemistry of paraffin-embedded Mouse brain using Histone H2AX antibody (NBP3-15378) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]](https://resources.rndsystems.com/images/products/Histone-H2AX-Antibody-4Z3S8-Immunohistochemistry-Paraffin-NBP3-15378-img0001.jpg "Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]")
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378] - Immunohistochemistry of paraffin-embedded Human liver cancer using Histone H2AX antibody (NBP3-15378) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]](https://resources.rndsystems.com/images/products/Histone-H2AX-Antibody-4Z3S8-Immunohistochemistry-Paraffin-NBP3-15378-img0002.jpg "Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]")
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378]
Immunohistochemistry-Paraffin: Histone H2AX Antibody (4Z3S8) [NBP3-15378] - Immunohistochemistry of paraffin-embedded Rat brain using Histone H2AX antibody (NBP3-15378) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Chromatin Immunoprecipitation: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Chromatin Immunoprecipitation: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Histone H2AX Rabbit mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Histone H2AX Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Histone H2AX Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Histone H2AX Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Western Blot: Histone H2AX Antibody (4Z3S8) [Histone H2AX] -
Western Blot: Histone H2AX Antibody (4Z3S8) [Histone H2AX] - Western blot analysis of various lysates using Histone H2AX Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Applications for Histone H2AX Antibody (4Z3S8)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
1:50-1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Histone H2AX
Alternate Names
H2AFX
Gene Symbol
H2AX
Additional Histone H2AX Products
Product Documents for Histone H2AX Antibody (4Z3S8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Histone H2AX Antibody (4Z3S8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Histone H2AX Antibody (4Z3S8)
There are currently no reviews for this product. Be the first to review Histone H2AX Antibody (4Z3S8) and earn rewards!
Have you used Histone H2AX Antibody (4Z3S8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...