Histone H2B Antibody (3U2P5)

Novus Biologicals | Catalog # NBP3-15598

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3U2P5 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814). KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone H2B Antibody (3U2P5)

Western Blot: Histone H2B Antibody (3U2P5) [NBP3-15598]

Western Blot: Histone H2B Antibody (3U2P5) [NBP3-15598]

Western Blot: Histone H2B Antibody (3U2P5) [NBP3-15598] - Western blot analysis of extracts of various cell lines, using Histone H2B antibody (NBP3-15598) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Histone H2B Antibody (3U2P5)

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] -

Immunohistochemistry: Histone H2B Antibody (3U2P5) [Histone H2B] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Histone H2B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Histone H2B Antibody (3U2P5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H2B

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility tothe cellular machineries which require DNA as a template. Histones thereby play a central role in transcriptionregulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set ofpost-translational modifications of histones, also called histone code, and nucleosome remodeling

Long Name

H2B Histone Family

Alternate Names

HIST1H2BK

Gene Symbol

H2BC18

Additional Histone H2B Products

Product Documents for Histone H2B Antibody (3U2P5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H2B Antibody (3U2P5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Histone H2B Antibody (3U2P5)

There are currently no reviews for this product. Be the first to review Histone H2B Antibody (3U2P5) and earn rewards!

Have you used Histone H2B Antibody (3U2P5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...