Histone H2B type 2E Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-03254
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Histone H2B type 2E (NP_003519.1). MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Histone H2B type 2E Antibody - Azide and BSA Free
Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] -
Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] - Western blot analysis of various lysates, using Histone H2B type 2E Rabbit pAb at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Mouse liver using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Human esophagus using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Rat kidney using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).Applications for Histone H2B type 2E Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:2000 - 1:10000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Histone H2B type 2E
Alternate Names
GL105, H2B, H2B Histone Family, Member Q, H2B.1, Histone 2, H2be, Histone Cluster 2 H2B Family Member E, Histone Cluster 2, H2be, Histone H2B Type 2-E, Histone H2B.Q, Histone H2B-GL105
Gene Symbol
H2BC21
Additional Histone H2B type 2E Products
Product Documents for Histone H2B type 2E Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Histone H2B type 2E Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for Histone H2B type 2E Antibody - Azide and BSA Free
Customer Reviews for Histone H2B type 2E Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Histone H2B type 2E Antibody - Azide and BSA Free and earn rewards!
Have you used Histone H2B type 2E Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...