Histone H2B type 2E Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03254

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Histone H2B type 2E (NP_003519.1). MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Histone H2B type 2E Antibody - Azide and BSA Free

Histone H2B type 2E Antibody - Azide and BSA Free

Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] -

Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] - Western blot analysis of various lysates, using Histone H2B type 2E Rabbit pAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Mouse liver using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Human esophagus using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]

Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Rat kidney using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).

Applications for Histone H2B type 2E Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H2B type 2E

Alternate Names

GL105, H2B, H2B Histone Family, Member Q, H2B.1, Histone 2, H2be, Histone Cluster 2 H2B Family Member E, Histone Cluster 2, H2be, Histone H2B Type 2-E, Histone H2B.Q, Histone H2B-GL105

Gene Symbol

H2BC21

Additional Histone H2B type 2E Products

Product Documents for Histone H2B type 2E Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H2B type 2E Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for Histone H2B type 2E Antibody - Azide and BSA Free

Customer Reviews for Histone H2B type 2E Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Histone H2B type 2E Antibody - Azide and BSA Free and earn rewards!

Have you used Histone H2B type 2E Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...