HLA DPB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89688

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HLA DPB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HLA DPB1 Antibody - BSA Free

HLA DPB1 Antibody - BSA Free Immunohistochemistry-Paraffin: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Analysis in human lymph node and cerebral cortex tissues using NBP1-89688 antibody. Corresponding HLA-DPB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human lymph node shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human tonsil shows strong membranous positivity in germinal center cells.
HLA DPB1 Antibody - BSA Free Immunohistochemistry-Paraffin: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Immunohistochemistry-Paraffin: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.
HLA DPB1 Antibody - BSA Free Western Blot: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Western Blot: HLA DPB1 Antibody - BSA Free [NBP1-89688]

Analysis in human cell line HDLM-2.

Applications for HLA DPB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DPB1

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Alternate Names

DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1

Gene Symbol

HLA-DPB1

Additional HLA DPB1 Products

Product Documents for HLA DPB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HLA DPB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DPB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA DPB1 Antibody - BSA Free and earn rewards!

Have you used HLA DPB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies