hnRNP A2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57166

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HNRNPA2B1(heterogeneous nuclear ribonucleoprotein A2/B1) The peptide sequence was selected from the N terminal of HNRNPA2B1. Peptide sequence MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for hnRNP A2B1 Antibody - BSA Free

Western Blot: hnRNP A2B1 Antibody [NBP1-57166]

Western Blot: hnRNP A2B1 Antibody [NBP1-57166]

Western Blot: hnRNP A2B1 Antibody [NBP1-57166] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: hnRNP A2B1 Antibody [NBP1-57166]

Immunohistochemistry: hnRNP A2B1 Antibody [NBP1-57166]

Immunohistochemistry: hnRNP A2B1 Antibody [NBP1-57166] - Human Heart cell Cellular data: cardiac cell of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Applications for hnRNP A2B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP A2B1

HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRNPA2B1 has two repeats of quasi-RRM domains that bind to RNAs.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

Alternate Names

DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 / hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1

Gene Symbol

HNRNPA2B1

UniProt

Additional hnRNP A2B1 Products

Product Documents for hnRNP A2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP A2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP A2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP A2B1 Antibody - BSA Free and earn rewards!

Have you used hnRNP A2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...