hnRNP C1 + C2 Antibody (7A10N5)
Novus Biologicals | Catalog # NBP3-16725
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7A10N5 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 80-170 of human hnRNP C1 + C2 (P07910). LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGK
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for hnRNP C1 + C2 Antibody (7A10N5)
Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]
Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Western blot analysis of extracts of various cell lines, using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Immunofluorescence analysis of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] -
Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Confocal imaging of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] -
Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Confocal imaging of paraffin-embedded Human colon cancer using hnRNP C1 + C2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for hnRNP C1 + C2 Antibody (7A10N5)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: hnRNP C1 + C2
Alternate Names
C1, C2, heterogeneous nuclear ribonucleoprotein C (C1/C2), heterogeneous nuclear ribonucleoproteins C1/C2, HNRNP, hnRNP C1/C2, hnRNPC, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, nuclear ribonucleoprotein particle C1 protein, nuclear ribonucleoprotein particle C2 protein, SNRPC
Gene Symbol
HNRNPC
Additional hnRNP C1 + C2 Products
Product Documents for hnRNP C1 + C2 Antibody (7A10N5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for hnRNP C1 + C2 Antibody (7A10N5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for hnRNP C1 + C2 Antibody (7A10N5)
There are currently no reviews for this product. Be the first to review hnRNP C1 + C2 Antibody (7A10N5) and earn rewards!
Have you used hnRNP C1 + C2 Antibody (7A10N5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...