hnRNP F Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57442

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP F Antibody - BSA Free

Western Blot: hnRNP F Antibody [NBP2-57442]

Western Blot: hnRNP F Antibody [NBP2-57442]

Western Blot: hnRNP F Antibody [NBP2-57442] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: hnRNP F Antibody [NBP2-57442]

Immunocytochemistry/ Immunofluorescence: hnRNP F Antibody [NBP2-57442]

Immunocytochemistry/Immunofluorescence: hnRNP F Antibody [NBP2-57442] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Applications for hnRNP F Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP F

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport, and also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. hnRNP complexes are the major constituents of the spliceosome and in particular, the hnRNP A1 protein is one of the major premRNA/ mRNA binding proteins and also one of the most abundant proteins in the nucleus. hnRNP A1 and A2/B1 regulate the processing of pre-mRNA by directly antagonizing the association of various splicing factors and by influencing the splice site selection on pre-mRNA. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. Most hnRNP proteins, including hnRNP C1 and C2, contain one or more RNA binding domains and are implicated in the processing of pre-mRNA. hnRNPs F and H are largely related factors that preferentially associate with poly(rG) regions on RNA. Isoforms of these proteins are often generated by alternative processing of the premRNA and by posttranslational modifications such as phosphorylation on serines and threonines and methylation of arginines.

Alternate Names

heterogeneous nuclear ribonucleoprotein F, hnRNP F, HNRPFHnRNP F protein, mcs94-1, MGC110997, Nucleolin-like protein mcs94-1, OK/SW-cl.23

Gene Symbol

HNRNPF

Additional hnRNP F Products

Product Documents for hnRNP F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP F Antibody - BSA Free and earn rewards!

Have you used hnRNP F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...