HNRPLL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85054

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HNRPLL. Peptide sequence: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HNRPLL Antibody - BSA Free

Western Blot: HNRPLL Antibody [NBP2-85054]

Western Blot: HNRPLL Antibody [NBP2-85054]

Western Blot: HNRPLL Antibody [NBP2-85054] - WB Suggested Anti-HNRPLL Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054]

Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054]

Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054] - Rabbit Anti-HNRPLL Antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: Myocardial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: HNRPLL Antibody [NBP2-85054]

Western Blot: HNRPLL Antibody [NBP2-85054]

Western Blot: HNRPLL Antibody [NBP2-85054] - Host: Rabbit. Target Name: HNRPLL. Sample Type: HepG2. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 2.5ug/mL. Peptide Concentration: 2.0ug/mL. Lysate Quantity: 25ug/lane. Gel Concentration: 12%
Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054]

Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054]

Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP2-85054] - Rabbit Anti-HNRPLL Antibody. Paraffin Embedded Tissue: Human Lung. Cellular Data: Alveolar cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for HNRPLL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRPLL

HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicingof CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer etal., 2008 (PubMed 18669861)).(supplied by OMIM)

Alternate Names

heterogeneous nuclear ribonucleoprotein L-like, hnRNPLL, SRRF, stromal RNA regulating factor, Stromal RNA-regulating factor

Gene Symbol

HNRNPLL

Additional HNRPLL Products

Product Documents for HNRPLL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HNRPLL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNRPLL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNRPLL Antibody - BSA Free and earn rewards!

Have you used HNRPLL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...