HOXB13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49375

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXB13 Antibody - BSA Free

Western Blot: HOXB13 Antibody [NBP2-49375]

Western Blot: HOXB13 Antibody [NBP2-49375]

Western Blot: HOXB13 Antibody [NBP2-49375] - Staining of human liver shows low expression as expected.
Immunocytochemistry/ Immunofluorescence: HOXB13 Antibody [NBP2-49375]

Immunocytochemistry/ Immunofluorescence: HOXB13 Antibody [NBP2-49375]

Immunocytochemistry/Immunofluorescence: HOXB13 Antibody [NBP2-49375] - Staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human colon.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining in human prostate and liver tissues using anti-HOXB13 antibody. Corresponding HOXB13 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human colon, liver, prostate and rectum using Anti-HOXB13 antibody NBP2-49375 (A) shows similar protein distribution across tissues to independent antibody NBP2-48778 (B).
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375]

Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human rectum.

Applications for HOXB13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB13

HOXB13 is a novel member of the AbdB subfamily of vertebrate HOX genes which are clustered in 4 unlinked complexes in the genome (HOXA, HOXB, HOXC, and HOXD clusters) which each span about 200 kb and contains 9 to 11 genes, transcribed from the same strand of DNA. The order of the HOX genes along the chromosome correlates with their expression along the anterior/posterior axis of the embryo and suggests that their organization is integral to their proper regulation. Members of the Abdominal B (AbdB) subfamily of homeobox genes exhibit posterior domains of expression, including the developing urogenital system, in vertebrates. Several HOXB genes have been described in humans and other mammals though it was thought that HOXB genes 10 through 13 had been lost in evolution until HOXB13 was discovered. HOXB13 gene contains 2 exons and encodes a 284-amino acid protein, 2 residues shorter than the mouse protein. It is separated from HOXB9 by 70 kb but is transcribed in the same orientation as the other HOXB genes. The 60-amino acid homeodomain, located near the C terminus of the protein, demonstrated 78 to 83% identity with HOX proteins in paralog group 13 of the AbdB subfamily; 6 of the amino acid differences from other member of this group represented conservative changes. HOXB13 had less than 60% identity to other AbdB-related genes. Mouse Hoxb13 is expressed first in the tailbud of embryonic mice and subsequently in the hindgut, urogenital tract, and the posterior extent of the spinal cord. It is not expressed in the secondary axes. During the first 2 trimesters of development, wound healing occurs without scars. Two homeobox genes, PRX2 and HOXB13, are differentially expressed during fetal versus adult wound healing. Both genes are expressed in proliferating fibroblasts and fetal dermis, but not in adult dermis. The HOXB13 gene has been mapped to human chromosome 17q21.2, where other HOXB genes are clustered, whilst the mouse Hoxb13 gene mapped to chromosome 11.

Long Name

Homeobox B13

Alternate Names

PSGD

Gene Symbol

HOXB13

Additional HOXB13 Products

Product Documents for HOXB13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB13 Antibody - BSA Free and earn rewards!

Have you used HOXB13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...