HOXB5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10906

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HOXB5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5 (NP_002138). Peptide sequence MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HOXB5 Antibody - BSA Free

Immunohistochemistry: HOXB5 Antibody [NBP3-10906]

Immunohistochemistry: HOXB5 Antibody [NBP3-10906]

Immunohistochemistry: HOXB5 Antibody [NBP3-10906] - Immunohistochemical analysis of human pancreas lysate.

Applications for HOXB5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB5

HOXB5 is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq]

Alternate Names

HHO.C10, homeo box 2A, homeo box B5, homeobox B5, Homeobox protein HHO.C10, Homeobox protein Hox-2A, homeobox protein Hox-B5, Homeobox protein Hu-1, Hox2.1, HOX2AHOX2, HU-1

Gene Symbol

HOXB5

Additional HOXB5 Products

Product Documents for HOXB5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB5 Antibody - BSA Free and earn rewards!

Have you used HOXB5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies