HP1 alpha Antibody (8C3M6)

Novus Biologicals | Catalog # NBP3-16267

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8C3M6 expressed in HEK293
View all HP1 alpha Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha (P45973). SNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HP1 alpha Antibody (8C3M6)

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Western blot analysis of extracts of various cell lines, using HP1 alphaRabbit mAb (NBP3-16267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Western blot analysis of extracts of various cell lines, using HP1 alphaRabbit mAb (NBP3-16267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Immunoprecipitation: HP1 alpha Antibody (8C3M6) [NBP3-16267]

Immunoprecipitation: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug HP1 alpha antibody (NBP3-16267). Western blot was performed from the immunoprecipitate using HP1 alpha antibody (NBP3-16267) at a dilition of 1:1000.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunocytochemistry/ Immunofluorescence: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunocytochemistry/ Immunofluorescence: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Confocal imaging of C6 cells using HP1 alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HP1 alpha Antibody (8C3M6)

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] -

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for HP1 alpha Antibody (8C3M6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:20-1:50

Immunoprecipitation

0.5 μg-4 μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HP1 alpha

Heterochromatin protein-1 (HP1) is a methyl-lysine binding adapter protein that is involved in a variety important functions in the cell nucleus. Localized at heterochromatin sites, HP1 is responsible for gene repression by heterochromatin formation, transcriptional activation, regulation of binding of cohesion complexes to centromere, sequesteration of genes to nuclear periphery, transcriptional arrest, maintenance of heterochromatin integrity, gene repression at single nucleosome level and gene repression by heterochromatization of euchromatin.

HP1 antibodies are useful tools for research on transcription regulation and epigenetic signaling.

Alternate Names

Antigen p25, chromobox homolog 5, chromobox homolog 5 (Drosophila HP1 alpha), chromobox homolog 5 (HP1 alpha homolog, Drosophila), chromobox protein homolog 5, Heterochromatin protein 1 homolog alpha, heterochromatin protein 1-alpha, HP1, HP1 alpha, HP1 alpha homolog, HP1A, HP1-ALPHA, HP1Hs alpha, HP1Hs-alpha

Gene Symbol

CBX5

Additional HP1 alpha Products

Product Documents for HP1 alpha Antibody (8C3M6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HP1 alpha Antibody (8C3M6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HP1 alpha Antibody (8C3M6)

There are currently no reviews for this product. Be the first to review HP1 alpha Antibody (8C3M6) and earn rewards!

Have you used HP1 alpha Antibody (8C3M6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies