HSD17B6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56686

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HSD17B6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HSD17B6(hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)) The peptide sequence was selected from the N terminal of HSD17B6 (NP_003716). Peptide sequence MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HSD17B6 Antibody - BSA Free

Western Blot: HSD17B6 Antibody [NBP1-56686]

Western Blot: HSD17B6 Antibody [NBP1-56686]

Western Blot: HSD17B6 Antibody [NBP1-56686] - A172 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP1-56686]

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP1-56686]

Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP1-56686] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for HSD17B6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSD17B6

HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.

Alternate Names

17-beta-HSD 6, 17-beta-HSD6, 17-beta-hydroxysteroid dehydrogenase type 6, 3(alpha->beta)-hydroxysteroid epimerase, 3-alpha->beta-HSE, EC 1.1.1, EC 1.1.1.105, EC 1.1.1.62, EC 1.1.1.63, HSE3-hydroxysteroid epimerase, hydroxysteroid (17-beta) dehydrogenase 6, hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse), NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase, Oxidative 3-alpha hydroxysteroid dehydrogenase, oxidative 3-alpha-hydroxysteroid-dehydrogenase, oxidoreductase, retinol dehydrogenase, RODH3(alpha->beta)-hydroxysteroid epimerasel, SDR9C6, short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase

Entrez Gene IDs

8630 (Human)

Gene Symbol

HSD17B6

UniProt

O14756 (Human)

Additional HSD17B6 Products

Product Documents for HSD17B6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSD17B6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HSD17B6 Antibody - BSA Free

Customer Reviews for HSD17B6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD17B6 Antibody - BSA Free and earn rewards!

Have you used HSD17B6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies